Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.6: Nucleoside diphosphate kinase, NDK [54919] (2 families) |
Family d.58.6.1: Nucleoside diphosphate kinase, NDK [54920] (2 proteins) |
Protein automated matches [190032] (18 species) not a true protein |
Species Slime mold (Dictyostelium discoideum) [TaxId:44689] [186756] (3 PDB entries) |
Domain d1s5zc_: 1s5z C: [118870] automated match to d1f6tb_ complexed with po4, son |
PDB Entry: 1s5z (more details), 2 Å
SCOPe Domain Sequences for d1s5zc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1s5zc_ d.58.6.1 (C:) automated matches {Slime mold (Dictyostelium discoideum) [TaxId: 44689]} vnkertflavkpdgvarglvgeiiaryekkgfvlvglkqlvptkdlaeshyaehkerpff gglvsfitsgpvvamvfegkgvvasarlmigvtnplasapgsirgdfgvdvgrniihgsd svesanreialwfkpeelltevkpnpnlye
Timeline for d1s5zc_: