![]() | Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.6: Nucleoside diphosphate kinase, NDK [54919] (2 families) ![]() |
![]() | Family d.58.6.1: Nucleoside diphosphate kinase, NDK [54920] (2 proteins) |
![]() | Protein automated matches [190032] (18 species) not a true protein |
![]() | Species Slime mold (Dictyostelium discoideum) [TaxId:44689] [186756] (3 PDB entries) |
![]() | Domain d1s5zb_: 1s5z B: [118869] automated match to d1f6tb_ complexed with po4, son |
PDB Entry: 1s5z (more details), 2 Å
SCOPe Domain Sequences for d1s5zb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1s5zb_ d.58.6.1 (B:) automated matches {Slime mold (Dictyostelium discoideum) [TaxId: 44689]} vnkertflavkpdgvarglvgeiiaryekkgfvlvglkqlvptkdlaeshyaehkerpff gglvsfitsgpvvamvfegkgvvasarlmigvtnplasapgsirgdfgvdvgrniihgsd svesanreialwfkpeelltevkpnpnlye
Timeline for d1s5zb_: