SCOPe 2.05: Domain d1s5zb_: 1s5z B:

Lineage for d1s5zb_ (1s5z B:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.6: Nucleoside diphosphate kinase, NDK [54919] (2 families)

5. Family d.58.6.1: Nucleoside diphosphate kinase, NDK [54920] (2 proteins)

6. Protein automated matches [190032] (15 species)
   not a true protein

7. Species Slime mold (Dictyostelium discoideum) [TaxId:44689] [186756] (3 PDB entries)

8. Domain d1s5zb_: 1s5z B: [118869]
   automated match to d1f6tb_
   complexed with po4, son

Details for d1s5zb_

PDB Entry: 1s5z, 2 Å

PDB Description: NDP kinase in complex with adenosine phosphonoacetic acid

PDB Compounds: (B:) Nucleoside diphosphate kinase, cytosolic

SCOPe Domain Sequences for d1s5zb_:

Sequence; same for both SEQRES and ATOM records:

>d1s5zb_ d.58.6.1 (B:) automated matches {Slime mold (Dictyostelium discoideum) [TaxId: 44689]}
vnkertflavkpdgvarglvgeiiaryekkgfvlvglkqlvptkdlaeshyaehkerpff
gglvsfitsgpvvamvfegkgvvasarlmigvtnplasapgsirgdfgvdvgrniihgsd
svesanreialwfkpeelltevkpnpnlye

Timeline for d1s5zb_:

• d1s5zb_ first appeared in SCOP 1.73, called d1s5zb1
  
• d1s5zb_ appears in SCOPe 2.04
  
• d1s5zb_ appears in SCOPe 2.06
  
• d1s5zb_ appears in the current release, SCOPe 2.08