SCOPe 2.01: Domain d1s55c_: 1s55 C:

Lineage for d1s55c_ (1s55 C:)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.22: TNF-like [49841] (1 superfamily)
   sandwich, 10 strands in 2 sheets; jelly-roll

4. Superfamily b.22.1: TNF-like [49842] (2 families)

5. Family b.22.1.1: TNF-like [49843] (15 proteins)

6. Protein TRANCE/RANKL cytokine [63721] (1 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [63722] (4 PDB entries)

8. Domain d1s55c_: 1s55 C: [118867]
   automated match to d1iqaa_
   complexed with cl

Details for d1s55c_

PDB Entry: 1s55, 1.9 Å

PDB Description: Mouse RANKL Structure at 1.9A Resolution

PDB Compounds: (C:) tumor necrosis factor ligand superfamily member 11

SCOPe Domain Sequences for d1s55c_:

Sequence; same for both SEQRES and ATOM records:

>d1s55c_ b.22.1.1 (C:) TRANCE/RANKL cytokine {Mouse (Mus musculus) [TaxId: 10090]}
aqpfahltinaasipsgshkvtlsswyhdrgwakisnmtlsngklrvnqdgfyylyanic
frhhetsgsvptdylqlmvyvvktsikipsshnlmkggstknwsgnsefhfysinvggff
klrageeisiqvsnpslldpdqdatyfgafkvqdid

Timeline for d1s55c_:

• d1s55c_ first appeared in SCOP 1.73, called d1s55c1
  
• d1s55c_ was called d1s55c1 in SCOP 1.75
  
• d1s55c_ appears in SCOPe 2.02
  
• d1s55c_ appears in the current release, SCOPe 2.08