Class b: All beta proteins [48724] (180 folds) |
Fold b.22: TNF-like [49841] (1 superfamily) sandwich, 10 strands in 2 sheets; jelly-roll |
Superfamily b.22.1: TNF-like [49842] (2 families) |
Family b.22.1.1: TNF-like [49843] (15 proteins) |
Protein TRANCE/RANKL cytokine [63721] (1 species) |
Species Mouse (Mus musculus) [TaxId:10090] [63722] (6 PDB entries) |
Domain d1s55c_: 1s55 C: [118867] automated match to d1iqaa_ complexed with cl |
PDB Entry: 1s55 (more details), 1.9 Å
SCOPe Domain Sequences for d1s55c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1s55c_ b.22.1.1 (C:) TRANCE/RANKL cytokine {Mouse (Mus musculus) [TaxId: 10090]} aqpfahltinaasipsgshkvtlsswyhdrgwakisnmtlsngklrvnqdgfyylyanic frhhetsgsvptdylqlmvyvvktsikipsshnlmkggstknwsgnsefhfysinvggff klrageeisiqvsnpslldpdqdatyfgafkvqdid
Timeline for d1s55c_: