Lineage for d1s55a1 (1s55 A:161-316)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 662724Fold b.22: TNF-like [49841] (1 superfamily)
    sandwich, 10 strands in 2 sheets; jelly-roll
  4. 662725Superfamily b.22.1: TNF-like [49842] (1 family) (S)
  5. 662726Family b.22.1.1: TNF-like [49843] (13 proteins)
  6. 662857Protein TRANCE/RANKL cytokine [63721] (1 species)
  7. 662858Species Mouse (Mus musculus) [TaxId:10090] [63722] (3 PDB entries)
  8. 662859Domain d1s55a1: 1s55 A:161-316 [118865]
    automatically matched to d1iqaa_
    complexed with cl

Details for d1s55a1

PDB Entry: 1s55 (more details), 1.9 Å

PDB Description: Mouse RANKL Structure at 1.9A Resolution
PDB Compounds: (A:) tumor necrosis factor ligand superfamily member 11

SCOP Domain Sequences for d1s55a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1s55a1 b.22.1.1 (A:161-316) TRANCE/RANKL cytokine {Mouse (Mus musculus) [TaxId: 10090]}
aqpfahltinaasipsgshkvtlsswyhdrgwakisnmtlsngklrvnqdgfyylyanic
frhhetsgsvptdylqlmvyvvktsikipsshnlmkggstknwsgnsefhfysinvggff
klrageeisiqvsnpslldpdqdatyfgafkvqdid

SCOP Domain Coordinates for d1s55a1:

Click to download the PDB-style file with coordinates for d1s55a1.
(The format of our PDB-style files is described here.)

Timeline for d1s55a1: