Lineage for d1s50a1 (1s50 A:2-117,A:120-259)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2520986Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2520987Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2520988Family c.94.1.1: Phosphate binding protein-like [53851] (45 proteins)
  6. 2521242Protein Glutamate receptor ligand binding core [53881] (5 species)
  7. 2521634Species Norway rat (Rattus norvegicus), GluR6 [TaxId:10116] [142801] (3 PDB entries)
    Uniprot P42260 421-544,668-804! Uniprot P42260 429-544,667-806
  8. 2521636Domain d1s50a1: 1s50 A:2-117,A:120-259 [118864]
    complexed with glu

Details for d1s50a1

PDB Entry: 1s50 (more details), 1.65 Å

PDB Description: x-ray structure of the glur6 ligand binding core (s1s2a) in complex with glutamate at 1.65 a resolution
PDB Compounds: (A:) Glutamate Receptor 6

SCOPe Domain Sequences for d1s50a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1s50a1 c.94.1.1 (A:2-117,A:120-259) Glutamate receptor ligand binding core {Norway rat (Rattus norvegicus), GluR6 [TaxId: 10116]}
snrslivttileepyvlfkksdkplygndrfegycidllrelstilgftyeirlvedgky
gaqddvngqwngmvrelidhkadlavaplaityvrekvidfskpfmtlgisilyrkXpid
saddlakqtkieygavedgatmtffkkskistydkmwafmssrrqsvlvksneegiqrvl
tsdyaflmesttiefvtqrncnltqigglidskgygvgtpmgspyrdkitiailqlqeeg
klhmmkekwwrgngcpe

SCOPe Domain Coordinates for d1s50a1:

Click to download the PDB-style file with coordinates for d1s50a1.
(The format of our PDB-style files is described here.)

Timeline for d1s50a1: