Lineage for d1s4cd_ (1s4c D:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2423914Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 2424882Superfamily b.82.2: Clavaminate synthase-like [51197] (16 families) (S)
    Iron and ketoglutarate-dependent enzymes; elaborated version of this common fold
  5. 2425140Family b.82.2.7: YhcH-like [89413] (1 protein)
    automatically mapped to Pfam PF04074
  6. 2425141Protein Hypothetical protein HI0227 [89414] (1 species)
  7. 2425142Species Haemophilus influenzae [TaxId:727] [89415] (2 PDB entries)
  8. 2425146Domain d1s4cd_: 1s4c D: [118863]
    automated match to d1jopa_
    complexed with act, cu

Details for d1s4cd_

PDB Entry: 1s4c (more details), 2.2 Å

PDB Description: yhch protein (hi0227) copper complex
PDB Compounds: (D:) Protein HI0227

SCOPe Domain Sequences for d1s4cd_:

Sequence, based on SEQRES records: (download)

>d1s4cd_ b.82.2.7 (D:) Hypothetical protein HI0227 {Haemophilus influenzae [TaxId: 727]}
miissltnpnfkvglpkviaevcdylntldlnalengrhdindqiymnvmepetaepssk
kaelhheyldvqvlirgtenievgatypnlskyedyneaddyqlcadiddkftvtmkpkm
favfypyephkpccvvngktekikklvvkvpvkli

Sequence, based on observed residues (ATOM records): (download)

>d1s4cd_ b.82.2.7 (D:) Hypothetical protein HI0227 {Haemophilus influenzae [TaxId: 727]}
miissltnpnfkvglpkviaevcdylntldlnalengrhdindqiymnvmepkaelhhey
ldvqvlirgtenievgatypnlskyedyneaddyqlcadiddkftvtmkpkmfavfypye
phkpccvikklvvkvpvkli

SCOPe Domain Coordinates for d1s4cd_:

Click to download the PDB-style file with coordinates for d1s4cd_.
(The format of our PDB-style files is described here.)

Timeline for d1s4cd_: