SCOP 1.73: Domain d1s4cd1: 1s4c D:1-143

Lineage for d1s4cd1 (1s4c D:1-143)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
   one turn of helix is made by two pairs of antiparallel strands linked with short turns
   has appearance of a sandwich of distinct architecture and jelly-roll topology

4. Superfamily b.82.2: Clavaminate synthase-like [51197] (12 families)
   Iron and ketoglutarate-dependent enzymes; elaborated version of this common fold

5. Family b.82.2.7: YhcH-like [89413] (1 protein)

6. Protein Hypothetical protein HI0227 [89414] (1 species)

7. Species Haemophilus influenzae [TaxId:727] [89415] (2 PDB entries)

8. Domain d1s4cd1: 1s4c D:1-143 [118863]
   automatically matched to d1jopa_
   complexed with act, cu

Details for d1s4cd1

PDB Entry: 1s4c, 2.2 Å

PDB Description: yhch protein (hi0227) copper complex

PDB Compounds: (D:) Protein HI0227

SCOP Domain Sequences for d1s4cd1:

Sequence, based on SEQRES records:

>d1s4cd1 b.82.2.7 (D:1-143) Hypothetical protein HI0227 {Haemophilus influenzae [TaxId: 727]}
miissltnpnfkvglpkviaevcdylntldlnalengrhdindqiymnvmepetaepssk
kaelhheyldvqvlirgtenievgatypnlskyedyneaddyqlcadiddkftvtmkpkm
favfypyephkpccvvngkteki

Sequence, based on observed residues (ATOM records):

>d1s4cd1 b.82.2.7 (D:1-143) Hypothetical protein HI0227 {Haemophilus influenzae [TaxId: 727]}
miissltnpnfkvglpkviaevcdylntldlnalengrhdindqiymnvmepkaelhhey
ldvqvlirgtenievgatypnlskyedyneaddyqlcadiddkftvtmkpkmfavfypye
phkpccvi

Timeline for d1s4cd1:

• d1s4cd1 is new in SCOP 1.73
  
• d1s4cd1 appears in SCOP 1.75
  
• d1s4cd1 appears in the current release, SCOPe 2.08, called d1s4cd_