SCOPe 2.07: Domain d1s4cc_: 1s4c C:

Lineage for d1s4cc_ (1s4c C:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
   one turn of helix is made by two pairs of antiparallel strands linked with short turns
   has appearance of a sandwich of distinct architecture and jelly-roll topology

4. Superfamily b.82.2: Clavaminate synthase-like [51197] (16 families)
   Iron and ketoglutarate-dependent enzymes; elaborated version of this common fold

5. Family b.82.2.7: YhcH-like [89413] (1 protein)
   automatically mapped to Pfam PF04074

6. Protein Hypothetical protein HI0227 [89414] (1 species)

7. Species Haemophilus influenzae [TaxId:727] [89415] (2 PDB entries)

8. Domain d1s4cc_: 1s4c C: [118862]
   automated match to d1jopa_
   complexed with act, cu

Details for d1s4cc_

PDB Entry: 1s4c, 2.2 Å

PDB Description: yhch protein (hi0227) copper complex

PDB Compounds: (C:) Protein HI0227

SCOPe Domain Sequences for d1s4cc_:

Sequence, based on SEQRES records:

>d1s4cc_ b.82.2.7 (C:) Hypothetical protein HI0227 {Haemophilus influenzae [TaxId: 727]}
miissltnpnfkvglpkviaevcdylntldlnalengrhdindqiymnvmepetaepssk
kaelhheyldvqvlirgtenievgatypnlskyedyneaddyqlcadiddkftvtmkpkm
favfypyephkpccvvngktekikklvvkvpvkli

Sequence, based on observed residues (ATOM records):

>d1s4cc_ b.82.2.7 (C:) Hypothetical protein HI0227 {Haemophilus influenzae [TaxId: 727]}
miissltnpnfkvglpkviaevcdylntldlnalengrhdindqiymnvmepkaelhhey
ldvqvlirgtenievgatypnlskyedyneaddyqlcadiddkftvtmkpkmfavfypye
phkpccvvngktekikklvvkvpvkli

Timeline for d1s4cc_:

• d1s4cc_ first appeared in SCOP 1.73, called d1s4cc1
  
• d1s4cc_ appears in SCOPe 2.06
  
• d1s4cc_ appears in the current release, SCOPe 2.08