Class b: All beta proteins [48724] (178 folds) |
Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies) one turn of helix is made by two pairs of antiparallel strands linked with short turns has appearance of a sandwich of distinct architecture and jelly-roll topology |
Superfamily b.82.2: Clavaminate synthase-like [51197] (16 families) Iron and ketoglutarate-dependent enzymes; elaborated version of this common fold |
Family b.82.2.7: YhcH-like [89413] (1 protein) automatically mapped to Pfam PF04074 |
Protein Hypothetical protein HI0227 [89414] (1 species) |
Species Haemophilus influenzae [TaxId:727] [89415] (2 PDB entries) |
Domain d1s4cc_: 1s4c C: [118862] automated match to d1jopa_ complexed with act, cu |
PDB Entry: 1s4c (more details), 2.2 Å
SCOPe Domain Sequences for d1s4cc_:
Sequence, based on SEQRES records: (download)
>d1s4cc_ b.82.2.7 (C:) Hypothetical protein HI0227 {Haemophilus influenzae [TaxId: 727]} miissltnpnfkvglpkviaevcdylntldlnalengrhdindqiymnvmepetaepssk kaelhheyldvqvlirgtenievgatypnlskyedyneaddyqlcadiddkftvtmkpkm favfypyephkpccvvngktekikklvvkvpvkli
>d1s4cc_ b.82.2.7 (C:) Hypothetical protein HI0227 {Haemophilus influenzae [TaxId: 727]} miissltnpnfkvglpkviaevcdylntldlnalengrhdindqiymnvmepkaelhhey ldvqvlirgtenievgatypnlskyedyneaddyqlcadiddkftvtmkpkmfavfypye phkpccvvngktekikklvvkvpvkli
Timeline for d1s4cc_: