Lineage for d1s4ca1 (1s4c A:1-143)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 677266Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 677672Superfamily b.82.2: Clavaminate synthase-like [51197] (12 families) (S)
    Iron and ketoglutarate-dependent enzymes; elaborated version of this common fold
  5. 677799Family b.82.2.7: YhcH-like [89413] (1 protein)
  6. 677800Protein Hypothetical protein HI0227 [89414] (1 species)
  7. 677801Species Haemophilus influenzae [TaxId:727] [89415] (2 PDB entries)
  8. 677802Domain d1s4ca1: 1s4c A:1-143 [118860]
    automatically matched to d1jopa_
    complexed with act, cu

Details for d1s4ca1

PDB Entry: 1s4c (more details), 2.2 Å

PDB Description: yhch protein (hi0227) copper complex
PDB Compounds: (A:) Protein HI0227

SCOP Domain Sequences for d1s4ca1:

Sequence, based on SEQRES records: (download)

>d1s4ca1 b.82.2.7 (A:1-143) Hypothetical protein HI0227 {Haemophilus influenzae [TaxId: 727]}
miissltnpnfkvglpkviaevcdylntldlnalengrhdindqiymnvmepetaepssk
kaelhheyldvqvlirgtenievgatypnlskyedyneaddyqlcadiddkftvtmkpkm
favfypyephkpccvvngkteki

Sequence, based on observed residues (ATOM records): (download)

>d1s4ca1 b.82.2.7 (A:1-143) Hypothetical protein HI0227 {Haemophilus influenzae [TaxId: 727]}
miissltnpnfkvglpkviaevcdylntldlnalengrhdindqiymnvmepetaepssk
kaelhheyldvqvlirgtenievgatypnlskyedyneaddyqlcadiddkftvtmkpkm
favfypyephkpccveki

SCOP Domain Coordinates for d1s4ca1:

Click to download the PDB-style file with coordinates for d1s4ca1.
(The format of our PDB-style files is described here.)

Timeline for d1s4ca1: