![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies) one turn of helix is made by two pairs of antiparallel strands linked with short turns has appearance of a sandwich of distinct architecture and jelly-roll topology |
![]() | Superfamily b.82.2: Clavaminate synthase-like [51197] (16 families) ![]() Iron and ketoglutarate-dependent enzymes; elaborated version of this common fold |
![]() | Family b.82.2.7: YhcH-like [89413] (1 protein) automatically mapped to Pfam PF04074 |
![]() | Protein Hypothetical protein HI0227 [89414] (1 species) |
![]() | Species Haemophilus influenzae [TaxId:727] [89415] (2 PDB entries) |
![]() | Domain d1s4ca_: 1s4c A: [118860] automated match to d1jopa_ complexed with act, cu |
PDB Entry: 1s4c (more details), 2.2 Å
SCOPe Domain Sequences for d1s4ca_:
Sequence, based on SEQRES records: (download)
>d1s4ca_ b.82.2.7 (A:) Hypothetical protein HI0227 {Haemophilus influenzae [TaxId: 727]} miissltnpnfkvglpkviaevcdylntldlnalengrhdindqiymnvmepetaepssk kaelhheyldvqvlirgtenievgatypnlskyedyneaddyqlcadiddkftvtmkpkm favfypyephkpccvvngktekikklvvkvpvkli
>d1s4ca_ b.82.2.7 (A:) Hypothetical protein HI0227 {Haemophilus influenzae [TaxId: 727]} miissltnpnfkvglpkviaevcdylntldlnalengrhdindqiymnvmepetaepssk kaelhheyldvqvlirgtenievgatypnlskyedyneaddyqlcadiddkftvtmkpkm favfypyephkpccvekikklvvkvpvkli
Timeline for d1s4ca_: