Lineage for d1s3qj1 (1s3q J:3-164)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 766018Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 766019Superfamily a.25.1: Ferritin-like [47240] (9 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 766020Family a.25.1.1: Ferritin [47241] (9 proteins)
  6. 766587Protein Non-hem ferritin [63524] (4 species)
  7. 766588Species Archaeon Archaeoglobus fulgidus [TaxId:2234] [140432] (2 PDB entries)
    Uniprot O29424 3-164
  8. 766598Domain d1s3qj1: 1s3q J:3-164 [118857]
    automatically matched to 1S3Q A:3-164
    complexed with zn

Details for d1s3qj1

PDB Entry: 1s3q (more details), 2.1 Å

PDB Description: Crystal structures of a novel open pore ferritin from the hyperthermophilic Archaeon Archaeoglobus fulgidus
PDB Compounds: (J:) Ferritin

SCOP Domain Sequences for d1s3qj1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1s3qj1 a.25.1.1 (J:3-164) Non-hem ferritin {Archaeon Archaeoglobus fulgidus [TaxId: 2234]}
sisekmvealnrqinaeiysaylylsmasyfdsiglkgfsnwmrvqwqeelmhamkmfdf
vserggrvklyaveeppsewdsplaafehvyehevnvtkrihelvemamqekdfatynfl
qwyvaeqveeeasaldiveklrligedkrallfldkelslrq

SCOP Domain Coordinates for d1s3qj1:

Click to download the PDB-style file with coordinates for d1s3qj1.
(The format of our PDB-style files is described here.)

Timeline for d1s3qj1: