Lineage for d1s3qg_ (1s3q G:)

  1. Root: SCOPe 2.08
  2. Class a: All alpha proteins [46456] (290 folds)
  3. Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. Family a.25.1.0: automated matches [191307] (1 protein)
    not a true family
  6. Protein automated matches [190036] (58 species)
    not a true protein
  7. Species Archaeoglobus fulgidus [TaxId:2234] [186755] (3 PDB entries)
  8. Domain d1s3qg_: 1s3q G: [118854]
    Other proteins in same PDB: d1s3qa1
    automated match to d1vlga_
    complexed with zn

Details for d1s3qg_

PDB Entry: 1s3q (more details), 2.1 Å

PDB Description: Crystal structures of a novel open pore ferritin from the hyperthermophilic Archaeon Archaeoglobus fulgidus
PDB Compounds: (G:) Ferritin

SCOPe Domain Sequences for d1s3qg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1s3qg_ a.25.1.0 (G:) automated matches {Archaeoglobus fulgidus [TaxId: 2234]}
asisekmvealnrqinaeiysaylylsmasyfdsiglkgfsnwmrvqwqeelmhamkmfd
fvserggrvklyaveeppsewdsplaafehvyehevnvtkrihelvemamqekdfatynf
lqwyvaeqveeeasaldiveklrligedkrallfldkelslrq

SCOPe Domain Coordinates for d1s3qg_ are not available.

Timeline for d1s3qg_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1s3qa1, d1s3qb_, d1s3qc_, d1s3qd_, d1s3qe_, d1s3qf_, d1s3qh_, d1s3qi_, d1s3qj_, d1s3qk_, d1s3ql_