Lineage for d1s3qd_ (1s3q D:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2314150Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 2314151Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 2317148Family a.25.1.0: automated matches [191307] (1 protein)
    not a true family
  6. 2317149Protein automated matches [190036] (58 species)
    not a true protein
  7. 2317166Species Archaeoglobus fulgidus [TaxId:2234] [186755] (3 PDB entries)
  8. 2317169Domain d1s3qd_: 1s3q D: [118851]
    Other proteins in same PDB: d1s3qa1
    automated match to d1vlga_
    complexed with zn

Details for d1s3qd_

PDB Entry: 1s3q (more details), 2.1 Å

PDB Description: Crystal structures of a novel open pore ferritin from the hyperthermophilic Archaeon Archaeoglobus fulgidus
PDB Compounds: (D:) Ferritin

SCOPe Domain Sequences for d1s3qd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1s3qd_ a.25.1.0 (D:) automated matches {Archaeoglobus fulgidus [TaxId: 2234]}
sisekmvealnrqinaeiysaylylsmasyfdsiglkgfsnwmrvqwqeelmhamkmfdf
vserggrvklyaveeppsewdsplaafehvyehevnvtkrihelvemamqekdfatynfl
qwyvaeqveeeasaldiveklrligedkrallfldkelslrq

SCOPe Domain Coordinates for d1s3qd_:

Click to download the PDB-style file with coordinates for d1s3qd_.
(The format of our PDB-style files is described here.)

Timeline for d1s3qd_: