Lineage for d1s3qa1 (1s3q A:3-164)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 910725Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 910726Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 910727Family a.25.1.1: Ferritin [47241] (10 proteins)
  6. 911400Protein Non-hem ferritin [63524] (5 species)
  7. 911401Species Archaeoglobus fulgidus [TaxId:2234] [140432] (1 PDB entry)
    Uniprot O29424 3-164
  8. 911402Domain d1s3qa1: 1s3q A:3-164 [118848]
    Other proteins in same PDB: d1s3qb_, d1s3qc_, d1s3qd_, d1s3qe_, d1s3qf_, d1s3qg_, d1s3qh_, d1s3qi_, d1s3qj_, d1s3qk_, d1s3ql_
    complexed with zn

Details for d1s3qa1

PDB Entry: 1s3q (more details), 2.1 Å

PDB Description: Crystal structures of a novel open pore ferritin from the hyperthermophilic Archaeon Archaeoglobus fulgidus
PDB Compounds: (A:) Ferritin

SCOPe Domain Sequences for d1s3qa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1s3qa1 a.25.1.1 (A:3-164) Non-hem ferritin {Archaeoglobus fulgidus [TaxId: 2234]}
sisekmvealnrqinaeiysaylylsmasyfdsiglkgfsnwmrvqwqeelmhamkmfdf
vserggrvklyaveeppsewdsplaafehvyehevnvtkrihelvemamqekdfatynfl
qwyvaeqveeeasaldiveklrligedkrallfldkelslrq

SCOPe Domain Coordinates for d1s3qa1:

Click to download the PDB-style file with coordinates for d1s3qa1.
(The format of our PDB-style files is described here.)

Timeline for d1s3qa1: