![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
![]() | Superfamily a.25.1: Ferritin-like [47240] (10 families) ![]() contains bimetal-ion centre in the middle of the bundle |
![]() | Family a.25.1.1: Ferritin [47241] (10 proteins) |
![]() | Protein Non-hem ferritin [63524] (7 species) |
![]() | Species Archaeoglobus fulgidus [TaxId:2234] [140432] (1 PDB entry) Uniprot O29424 3-164 |
![]() | Domain d1s3qa1: 1s3q A:3-164 [118848] Other proteins in same PDB: d1s3qb_, d1s3qc_, d1s3qd_, d1s3qe_, d1s3qf_, d1s3qg_, d1s3qh_, d1s3qi_, d1s3qj_, d1s3qk_, d1s3ql_ complexed with zn |
PDB Entry: 1s3q (more details), 2.1 Å
SCOPe Domain Sequences for d1s3qa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1s3qa1 a.25.1.1 (A:3-164) Non-hem ferritin {Archaeoglobus fulgidus [TaxId: 2234]} sisekmvealnrqinaeiysaylylsmasyfdsiglkgfsnwmrvqwqeelmhamkmfdf vserggrvklyaveeppsewdsplaafehvyehevnvtkrihelvemamqekdfatynfl qwyvaeqveeeasaldiveklrligedkrallfldkelslrq
Timeline for d1s3qa1: