Lineage for d1s2ma2 (1s2m A:252-422)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2870646Family c.37.1.19: Tandem AAA-ATPase domain [81268] (41 proteins)
    duplication: tandem repeat of two RecA-like (AAA) domains
  6. Protein Putative ATP-dependent RNA helicase DHH1, C-terminal domain [418971] (1 species)
  7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [419435] (1 PDB entry)
    Uniprot P39517
  8. 2870821Domain d1s2ma2: 1s2m A:252-422 [118845]
    Other proteins in same PDB: d1s2ma1

Details for d1s2ma2

PDB Entry: 1s2m (more details), 2.1 Å

PDB Description: Crystal Structure of the DEAD box protein Dhh1p
PDB Compounds: (A:) Putative ATP-dependent RNA helicase DHH1

SCOPe Domain Sequences for d1s2ma2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1s2ma2 c.37.1.19 (A:252-422) Putative ATP-dependent RNA helicase DHH1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
eltlkgitqyyafveerqklhclntlfsklqinqaiifcnstnrvellakkitdlgyscy
ysharmkqqernkvfhefrqgkvrtlvcsdlltrgidiqavnvvinfdfpktaetylhri
grsgrfghlglainlinwndrfnlykieqelgteiaaipatidkslyvaen

SCOPe Domain Coordinates for d1s2ma2:

Click to download the PDB-style file with coordinates for d1s2ma2.
(The format of our PDB-style files is described here.)

Timeline for d1s2ma2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1s2ma1