Lineage for d1s2ma1 (1s2m A:46-251)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2109203Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2109204Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2113231Family c.37.1.19: Tandem AAA-ATPase domain [81268] (24 protein domains)
    duplication: tandem repeat of two RecA-like (AAA) domains
  6. 2113350Protein Putative ATP-dependent RNA helicase DHH1 [142322] (1 species)
  7. 2113351Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [142323] (1 PDB entry)
    Uniprot P39517 252-422! Uniprot P39517 46-251
  8. 2113352Domain d1s2ma1: 1s2m A:46-251 [118844]

Details for d1s2ma1

PDB Entry: 1s2m (more details), 2.1 Å

PDB Description: Crystal Structure of the DEAD box protein Dhh1p
PDB Compounds: (A:) Putative ATP-dependent RNA helicase DHH1

SCOPe Domain Sequences for d1s2ma1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1s2ma1 c.37.1.19 (A:46-251) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
ntfedfylkrellmgifeagfekpspiqeeaipvaitgrdilarakngtgktaafviptl
ekvkpklnkiqalimvptrelalqtsqvvrtlgkhcgiscmvttggtnlrddilrlnetv
hilvgtpgrvldlasrkvadlsdcslfimdeadkmlsrdfktiieqilsflppthqsllf
satfpltvkefmvkhlhkpyeinlme

SCOPe Domain Coordinates for d1s2ma1:

Click to download the PDB-style file with coordinates for d1s2ma1.
(The format of our PDB-style files is described here.)

Timeline for d1s2ma1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1s2ma2