| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) ![]() division into families based on beta-sheet topologies |
| Family c.37.1.19: Tandem AAA-ATPase domain [81268] (41 proteins) duplication: tandem repeat of two RecA-like (AAA) domains |
| Protein Putative ATP-dependent RNA helicase DHH1, N-terminal domain [418970] (1 species) |
| Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [419434] (1 PDB entry) Uniprot P39517 |
| Domain d1s2ma1: 1s2m A:46-251 [118844] Other proteins in same PDB: d1s2ma2 has additional insertions and/or extensions that are not grouped together |
PDB Entry: 1s2m (more details), 2.1 Å
SCOPe Domain Sequences for d1s2ma1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1s2ma1 c.37.1.19 (A:46-251) Putative ATP-dependent RNA helicase DHH1, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
ntfedfylkrellmgifeagfekpspiqeeaipvaitgrdilarakngtgktaafviptl
ekvkpklnkiqalimvptrelalqtsqvvrtlgkhcgiscmvttggtnlrddilrlnetv
hilvgtpgrvldlasrkvadlsdcslfimdeadkmlsrdfktiieqilsflppthqsllf
satfpltvkefmvkhlhkpyeinlme
Timeline for d1s2ma1: