SCOPe 2.08: Domain d1s2ma1: 1s2m A:46-251

Lineage for d1s2ma1 (1s2m A:46-251)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.19: Tandem AAA-ATPase domain [81268] (41 proteins)
   duplication: tandem repeat of two RecA-like (AAA) domains

6. Protein Putative ATP-dependent RNA helicase DHH1, N-terminal domain [418970] (1 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [419434] (1 PDB entry)
   Uniprot P39517

8. Domain d1s2ma1: 1s2m A:46-251 [118844]
   Other proteins in same PDB: d1s2ma2
   has additional insertions and/or extensions that are not grouped together

Details for d1s2ma1

PDB Entry: 1s2m, 2.1 Å

PDB Description: Crystal Structure of the DEAD box protein Dhh1p

PDB Compounds: (A:) Putative ATP-dependent RNA helicase DHH1

SCOPe Domain Sequences for d1s2ma1:

Sequence; same for both SEQRES and ATOM records:

>d1s2ma1 c.37.1.19 (A:46-251) Putative ATP-dependent RNA helicase DHH1, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
ntfedfylkrellmgifeagfekpspiqeeaipvaitgrdilarakngtgktaafviptl
ekvkpklnkiqalimvptrelalqtsqvvrtlgkhcgiscmvttggtnlrddilrlnetv
hilvgtpgrvldlasrkvadlsdcslfimdeadkmlsrdfktiieqilsflppthqsllf
satfpltvkefmvkhlhkpyeinlme

Timeline for d1s2ma1:

• d1s2ma1 first appeared in SCOP 1.73
  
• d1s2ma1 appears in SCOPe 2.07