SCOPe 2.07: Domain d1s1sa_: 1s1s A:

Lineage for d1s1sa_ (1s1s A:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.129: TBP-like [55944] (11 superfamilies)
   beta-alpha-beta(4)-alpha

4. Superfamily d.129.4: Cell-division protein ZipA, C-terminal domain [64383] (1 family)
   contains a single copy of this fold
   automatically mapped to Pfam PF04354

5. Family d.129.4.1: Cell-division protein ZipA, C-terminal domain [64384] (2 proteins)

6. Protein Cell-division protein ZipA, C-terminal domain [64385] (1 species)

7. Species Escherichia coli [TaxId:562] [64386] (6 PDB entries)

8. Domain d1s1sa_: 1s1s A: [118842]
   automated match to d1f47b_
   complexed with wac

Details for d1s1sa_

PDB Entry: 1s1s, 2.1 Å

PDB Description: Crystal Structure of ZipA in complex with indoloquinolizin 10b

PDB Compounds: (A:) cell division protein zipa

SCOPe Domain Sequences for d1s1sa_:

Sequence; same for both SEQRES and ATOM records:

>d1s1sa_ d.129.4.1 (A:) Cell-division protein ZipA, C-terminal domain {Escherichia coli [TaxId: 562]}
rkeaviimnvaahhgselngelllnsiqqagfifgdmniyhrhlspdgsgpalfslanmv
kpgtfdpemkdfttpgvtifmqvpsygdelqlfklmlqsaqhiadevggvvlddqrrmmt
pqklreyqdiirevkdana

Timeline for d1s1sa_:

• d1s1sa_ first appeared in SCOP 1.73, called d1s1sa1
  
• d1s1sa_ appears in SCOPe 2.06
  
• d1s1sa_ appears in the current release, SCOPe 2.08