![]() | Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
![]() | Fold d.129: TBP-like [55944] (11 superfamilies) beta-alpha-beta(4)-alpha |
![]() | Superfamily d.129.4: Cell-division protein ZipA, C-terminal domain [64383] (1 family) ![]() contains a single copy of this fold automatically mapped to Pfam PF04354 |
![]() | Family d.129.4.1: Cell-division protein ZipA, C-terminal domain [64384] (2 proteins) |
![]() | Protein Cell-division protein ZipA, C-terminal domain [64385] (1 species) |
![]() | Species Escherichia coli [TaxId:562] [64386] (6 PDB entries) |
![]() | Domain d1s1sa_: 1s1s A: [118842] automated match to d1f47b_ complexed with wac |
PDB Entry: 1s1s (more details), 2.1 Å
SCOPe Domain Sequences for d1s1sa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1s1sa_ d.129.4.1 (A:) Cell-division protein ZipA, C-terminal domain {Escherichia coli [TaxId: 562]} rkeaviimnvaahhgselngelllnsiqqagfifgdmniyhrhlspdgsgpalfslanmv kpgtfdpemkdfttpgvtifmqvpsygdelqlfklmlqsaqhiadevggvvlddqrrmmt pqklreyqdiirevkdana
Timeline for d1s1sa_: