Lineage for d1s1sa1 (1s1s A:6-144)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 872515Fold d.129: TBP-like [55944] (11 superfamilies)
    beta-alpha-beta(4)-alpha
  4. 872952Superfamily d.129.4: Cell-division protein ZipA, C-terminal domain [64383] (1 family) (S)
    contains a single copy of this fold
  5. 872953Family d.129.4.1: Cell-division protein ZipA, C-terminal domain [64384] (1 protein)
  6. 872954Protein Cell-division protein ZipA, C-terminal domain [64385] (1 species)
  7. 872955Species Escherichia coli [TaxId:562] [64386] (8 PDB entries)
  8. 872964Domain d1s1sa1: 1s1s A:6-144 [118842]
    automatically matched to d1f47b_
    complexed with wac

Details for d1s1sa1

PDB Entry: 1s1s (more details), 2.1 Å

PDB Description: Crystal Structure of ZipA in complex with indoloquinolizin 10b
PDB Compounds: (A:) cell division protein zipa

SCOP Domain Sequences for d1s1sa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1s1sa1 d.129.4.1 (A:6-144) Cell-division protein ZipA, C-terminal domain {Escherichia coli [TaxId: 562]}
rkeaviimnvaahhgselngelllnsiqqagfifgdmniyhrhlspdgsgpalfslanmv
kpgtfdpemkdfttpgvtifmqvpsygdelqlfklmlqsaqhiadevggvvlddqrrmmt
pqklreyqdiirevkdana

SCOP Domain Coordinates for d1s1sa1:

Click to download the PDB-style file with coordinates for d1s1sa1.
(The format of our PDB-style files is described here.)

Timeline for d1s1sa1: