Lineage for d1s1sa_ (1s1s A:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2538746Fold d.129: TBP-like [55944] (11 superfamilies)
    beta-alpha-beta(4)-alpha
  4. 2539546Superfamily d.129.4: Cell-division protein ZipA, C-terminal domain [64383] (1 family) (S)
    contains a single copy of this fold
    automatically mapped to Pfam PF04354
  5. 2539547Family d.129.4.1: Cell-division protein ZipA, C-terminal domain [64384] (2 proteins)
  6. 2539548Protein Cell-division protein ZipA, C-terminal domain [64385] (1 species)
  7. 2539549Species Escherichia coli [TaxId:562] [64386] (6 PDB entries)
  8. 2539555Domain d1s1sa_: 1s1s A: [118842]
    automated match to d1f47b_
    complexed with wac

Details for d1s1sa_

PDB Entry: 1s1s (more details), 2.1 Å

PDB Description: Crystal Structure of ZipA in complex with indoloquinolizin 10b
PDB Compounds: (A:) cell division protein zipa

SCOPe Domain Sequences for d1s1sa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1s1sa_ d.129.4.1 (A:) Cell-division protein ZipA, C-terminal domain {Escherichia coli [TaxId: 562]}
rkeaviimnvaahhgselngelllnsiqqagfifgdmniyhrhlspdgsgpalfslanmv
kpgtfdpemkdfttpgvtifmqvpsygdelqlfklmlqsaqhiadevggvvlddqrrmmt
pqklreyqdiirevkdana

SCOPe Domain Coordinates for d1s1sa_:

Click to download the PDB-style file with coordinates for d1s1sa_.
(The format of our PDB-style files is described here.)

Timeline for d1s1sa_: