Lineage for d1s1ab1 (1s1a B:1-241)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 663169Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 663170Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (25 families) (S)
  5. 663171Family b.29.1.1: Legume lectins [49900] (4 proteins)
  6. 663301Protein Legume lectin [49904] (23 species)
  7. 663305Species Bloodwood tree (Pterocarpus angolensis) [TaxId:182271] [82032] (24 PDB entries)
  8. 663319Domain d1s1ab1: 1s1a B:1-241 [118841]
    automatically matched to d1n3oa_
    complexed with ca, man, mma, mn

Details for d1s1ab1

PDB Entry: 1s1a (more details), 1.8 Å

PDB Description: Pterocarpus angolensis seed lectin (PAL) with one binding site free and one binding site containing the disaccharide Man(a1-3)ManMe
PDB Compounds: (B:) lectin

SCOP Domain Sequences for d1s1ab1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1s1ab1 b.29.1.1 (B:1-241) Legume lectin {Bloodwood tree (Pterocarpus angolensis) [TaxId: 182271]}
qdslsfgfptfpsdqknlifqgdaqiknnavqltktdsngnpvastvgrilfsaqvhlwe
ksssrvanfqsqfsfslksplsngadgiaffiappdttipsgsgggllglfapgtaqnts
anqviavefdtfyaqdsntwdpnyphigidvnsirsvktvkwdrrdgqslnvlvtfnpst
rnldvvatysdgtryevsyevdvrsvlpewvrvgfsaasgeqyqthtleswsftstllyt
a

SCOP Domain Coordinates for d1s1ab1:

Click to download the PDB-style file with coordinates for d1s1ab1.
(The format of our PDB-style files is described here.)

Timeline for d1s1ab1: