Lineage for d1s1aa_ (1s1a A:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1779936Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 1779937Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 1779938Family b.29.1.1: Legume lectins [49900] (5 proteins)
  6. 1780474Protein automated matches [190035] (21 species)
    not a true protein
  7. 1780475Species Bloodwood tree (Pterocarpus angolensis) [TaxId:182271] [186754] (21 PDB entries)
  8. 1780488Domain d1s1aa_: 1s1a A: [118840]
    automated match to d1n3oa_
    complexed with ca, mn

Details for d1s1aa_

PDB Entry: 1s1a (more details), 1.8 Å

PDB Description: Pterocarpus angolensis seed lectin (PAL) with one binding site free and one binding site containing the disaccharide Man(a1-3)ManMe
PDB Compounds: (A:) lectin

SCOPe Domain Sequences for d1s1aa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1s1aa_ b.29.1.1 (A:) automated matches {Bloodwood tree (Pterocarpus angolensis) [TaxId: 182271]}
qdslsfgfptfpsdqknlifqgdaqiknnavqltktdsngnpvastvgrilfsaqvhlwe
ksssrvanfqsqfsfslksplsngadgiaffiappdttipsgsgggllglfapgtaqnts
anqviavefdtfyaqdsntwdpnyphigidvnsirsvktvkwdrrdgqslnvlvtfnpst
rnldvvatysdgtryevsyevdvrsvlpewvrvgfsaasgeqyqthtleswsftstllyt
a

SCOPe Domain Coordinates for d1s1aa_:

Click to download the PDB-style file with coordinates for d1s1aa_.
(The format of our PDB-style files is described here.)

Timeline for d1s1aa_: