Class b: All beta proteins [48724] (165 folds) |
Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (25 families) |
Family b.29.1.1: Legume lectins [49900] (4 proteins) |
Protein Legume lectin [49904] (23 species) |
Species Bloodwood tree (Pterocarpus angolensis) [TaxId:182271] [82032] (24 PDB entries) |
Domain d1s1aa1: 1s1a A:1-241 [118840] automatically matched to d1n3oa_ complexed with ca, man, mma, mn |
PDB Entry: 1s1a (more details), 1.8 Å
SCOP Domain Sequences for d1s1aa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1s1aa1 b.29.1.1 (A:1-241) Legume lectin {Bloodwood tree (Pterocarpus angolensis) [TaxId: 182271]} qdslsfgfptfpsdqknlifqgdaqiknnavqltktdsngnpvastvgrilfsaqvhlwe ksssrvanfqsqfsfslksplsngadgiaffiappdttipsgsgggllglfapgtaqnts anqviavefdtfyaqdsntwdpnyphigidvnsirsvktvkwdrrdgqslnvlvtfnpst rnldvvatysdgtryevsyevdvrsvlpewvrvgfsaasgeqyqthtleswsftstllyt a
Timeline for d1s1aa1: