Lineage for d1s1aa1 (1s1a A:1-241)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 663169Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 663170Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (25 families) (S)
  5. 663171Family b.29.1.1: Legume lectins [49900] (4 proteins)
  6. 663301Protein Legume lectin [49904] (23 species)
  7. 663305Species Bloodwood tree (Pterocarpus angolensis) [TaxId:182271] [82032] (24 PDB entries)
  8. 663318Domain d1s1aa1: 1s1a A:1-241 [118840]
    automatically matched to d1n3oa_
    complexed with ca, man, mma, mn

Details for d1s1aa1

PDB Entry: 1s1a (more details), 1.8 Å

PDB Description: pterocarpus angolensis seed lectin (pal) with one binding site free and one binding site containing the disaccharide man(a1-3)manme
PDB Compounds: (A:) lectin

SCOP Domain Sequences for d1s1aa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1s1aa1 b.29.1.1 (A:1-241) Legume lectin {Bloodwood tree (Pterocarpus angolensis) [TaxId: 182271]}
qdslsfgfptfpsdqknlifqgdaqiknnavqltktdsngnpvastvgrilfsaqvhlwe
ksssrvanfqsqfsfslksplsngadgiaffiappdttipsgsgggllglfapgtaqnts
anqviavefdtfyaqdsntwdpnyphigidvnsirsvktvkwdrrdgqslnvlvtfnpst
rnldvvatysdgtryevsyevdvrsvlpewvrvgfsaasgeqyqthtleswsftstllyt
a

SCOP Domain Coordinates for d1s1aa1:

Click to download the PDB-style file with coordinates for d1s1aa1.
(The format of our PDB-style files is described here.)

Timeline for d1s1aa1: