Lineage for d1s0ra1 (1s0r A:1-223)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 802045Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 802046Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) (S)
  5. 802237Family b.47.1.2: Eukaryotic proteases [50514] (47 proteins)
  6. 803036Protein Trypsin(ogen) [50515] (9 species)
  7. 803037Species Cow (Bos taurus) [TaxId:9913] [50516] (279 PDB entries)
    Uniprot P00760
  8. 803041Domain d1s0ra1: 1s0r A:1-223 [118839]
    automatically matched to d1tgsz_
    complexed with ben, ca

Details for d1s0ra1

PDB Entry: 1s0r (more details), 1.02 Å

PDB Description: bovine pancreatic trypsin inhibited with benzamidine at atomic resolution
PDB Compounds: (A:) trypsinogen

SCOP Domain Sequences for d1s0ra1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1s0ra1 b.47.1.2 (A:1-223) Trypsin(ogen) {Cow (Bos taurus) [TaxId: 9913]}
ivggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedninvveg
neqfisasksivhpsynsntlnndimliklksaaslnsrvasislptscasagtqclisg
wgntkssgtsypdvlkclkapilsdsscksaypgqitsnmfcagyleggkdscqgdsggp
vvcsgklqgivswgsgcaqknkpgvytkvcnyvswikqtiasn

SCOP Domain Coordinates for d1s0ra1:

Click to download the PDB-style file with coordinates for d1s0ra1.
(The format of our PDB-style files is described here.)

Timeline for d1s0ra1: