Class a: All alpha proteins [46456] (284 folds) |
Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
Superfamily a.1.1: Globin-like [46458] (5 families) |
Family a.1.1.2: Globins [46463] (27 proteins) Heme-binding protein |
Protein Hemoglobin, beta-chain [46500] (25 species) |
Species Donkey (Equus asinus) [TaxId:9793] [158216] (1 PDB entry) beta-chain sequences of donkey and horse hemoglobins are identical |
Domain d1s0hb1: 1s0h B:1-146 [118837] Other proteins in same PDB: d1s0ha1 complexed with hem |
PDB Entry: 1s0h (more details), 3 Å
SCOPe Domain Sequences for d1s0hb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1s0hb1 a.1.1.2 (B:1-146) Hemoglobin, beta-chain {Donkey (Equus asinus) [TaxId: 9793]} vqlsgeekaavlalwdkvneeevggealgrllvvypwtqrffdsfgdlsnpgavmgnpkv kahgkkvlhsfgegvhhldnlkgtfaalselhcdklhvdpenfrllgnvlvvvlarhfgk dftpelqasyqkvvagvanalahkyh
Timeline for d1s0hb1: