SCOP 1.75: Domain d1s0hb1: 1s0h B:1-146

Lineage for d1s0hb1 (1s0h B:1-146)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (4 families)

5. Family a.1.1.2: Globins [46463] (26 proteins)
   Heme-binding protein

6. Protein Hemoglobin, beta-chain [46500] (24 species)

7. Species Donkey (Equus asinus) [TaxId:9793] [158216] (1 PDB entry)
   beta-chain sequences of donkey and horse hemoglobins are identical

8. Domain d1s0hb1: 1s0h B:1-146 [118837]
   Other proteins in same PDB: d1s0ha1
   complexed with hem

Details for d1s0hb1

PDB Entry: 1s0h, 3 Å

PDB Description: structure determination of haemoglobin from donkey(equus asinus) at 3.0 angstrom resolution

PDB Compounds: (B:) hemoglobin beta chain

SCOP Domain Sequences for d1s0hb1:

Sequence; same for both SEQRES and ATOM records:

>d1s0hb1 a.1.1.2 (B:1-146) Hemoglobin, beta-chain {Donkey (Equus asinus) [TaxId: 9793]}
vqlsgeekaavlalwdkvneeevggealgrllvvypwtqrffdsfgdlsnpgavmgnpkv
kahgkkvlhsfgegvhhldnlkgtfaalselhcdklhvdpenfrllgnvlvvvlarhfgk
dftpelqasyqkvvagvanalahkyh

Timeline for d1s0hb1:

• d1s0hb1 first appeared in SCOP 1.73
  
• d1s0hb1 appears in SCOPe 2.01
  
• d1s0hb1 appears in the current release, SCOPe 2.08