Class a: All alpha proteins [46456] (258 folds) |
Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
Superfamily a.1.1: Globin-like [46458] (4 families) |
Family a.1.1.2: Globins [46463] (26 proteins) Heme-binding protein |
Protein Hemoglobin, beta-chain [46500] (22 species) |
Species Horse (Equus caballus) [TaxId:9796] [46504] (10 PDB entries) |
Domain d1s0hb1: 1s0h B:1-146 [118837] automatically matched to d1g0bb_ complexed with hem |
PDB Entry: 1s0h (more details), 3 Å
SCOP Domain Sequences for d1s0hb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1s0hb1 a.1.1.2 (B:1-146) Hemoglobin, beta-chain {Horse (Equus caballus) [TaxId: 9796]} vqlsgeekaavlalwdkvneeevggealgrllvvypwtqrffdsfgdlsnpgavmgnpkv kahgkkvlhsfgegvhhldnlkgtfaalselhcdklhvdpenfrllgnvlvvvlarhfgk dftpelqasyqkvvagvanalahkyh
Timeline for d1s0hb1: