Lineage for d1s0hb1 (1s0h B:1-146)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2299347Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 2299348Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 2299432Family a.1.1.2: Globins [46463] (27 protein domains)
    Heme-binding protein
  6. 2300379Protein Hemoglobin, beta-chain [46500] (26 species)
  7. 2300451Species Donkey (Equus asinus) [TaxId:9793] [158216] (1 PDB entry)
    beta-chain sequences of donkey and horse hemoglobins are identical
  8. 2300452Domain d1s0hb1: 1s0h B:1-146 [118837]
    Other proteins in same PDB: d1s0ha1
    complexed with hem

Details for d1s0hb1

PDB Entry: 1s0h (more details), 3 Å

PDB Description: structure determination of haemoglobin from donkey(equus asinus) at 3.0 angstrom resolution
PDB Compounds: (B:) hemoglobin beta chain

SCOPe Domain Sequences for d1s0hb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1s0hb1 a.1.1.2 (B:1-146) Hemoglobin, beta-chain {Donkey (Equus asinus) [TaxId: 9793]}
vqlsgeekaavlalwdkvneeevggealgrllvvypwtqrffdsfgdlsnpgavmgnpkv
kahgkkvlhsfgegvhhldnlkgtfaalselhcdklhvdpenfrllgnvlvvvlarhfgk
dftpelqasyqkvvagvanalahkyh

SCOPe Domain Coordinates for d1s0hb1:

Click to download the PDB-style file with coordinates for d1s0hb1.
(The format of our PDB-style files is described here.)

Timeline for d1s0hb1: