SCOP 1.73: Domain d1ryyh1: 1ryy H:435-666

Lineage for d1ryyh1 (1ryy H:435-666)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
   sandwich; 9 strands in 2 sheets; jelly-roll

4. Superfamily b.18.1: Galactose-binding domain-like [49785] (30 families)

5. Family b.18.1.13: PepX C-terminal domain-like [69222] (3 proteins)

6. Protein Alpha-amino acid ester hydrolase [89247] (2 species)

7. Species Acetobacter pasteurianus [TaxId:438] [101591] (4 PDB entries)

8. Domain d1ryyh1: 1ryy H:435-666 [118835]
   Other proteins in same PDB: d1ryya2, d1ryyb2, d1ryyc2, d1ryyd2, d1ryye2, d1ryyf2, d1ryyg2, d1ryyh2
   automatically matched to d1nx9a1
   mutant

Details for d1ryyh1

PDB Entry: 1ryy, 2.8 Å

PDB Description: acetobacter turbidans alpha-amino acid ester hydrolase y206a mutant

PDB Compounds: (H:) alpha-amino acid ester hydrolase

SCOP Domain Sequences for d1ryyh1:

Sequence; same for both SEQRES and ATOM records:

>d1ryyh1 b.18.1.13 (H:435-666) Alpha-amino acid ester hydrolase {Acetobacter pasteurianus [TaxId: 438]}
psvcesnctggltplyladghglsfthpaadgadsyvsdpahpvpfisrpfafaqssrwk
pwlvqdqreaesrpdvvtyetevldepvrvsgvpvadlfaatsgtdsdwvvklidvqpam
tpddpkmggyelpvsmdifrgryrkdfakpealqpdatlhyhftlpavnhvfakghrimv
qiqsswfplydrnpqkfvpnifdakpadytvatqsihhggkeatsillpvvk

Timeline for d1ryyh1:

• d1ryyh1 is new in SCOP 1.73
  
• d1ryyh1 appears in SCOP 1.75
  
• d1ryyh1 appears in the current release, SCOPe 2.08