Lineage for d1ryic2 (1ryi C:219-306)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2542330Fold d.16: FAD-linked reductases, C-terminal domain [54372] (1 superfamily)
    alpha+beta sandwich
  4. 2542331Superfamily d.16.1: FAD-linked reductases, C-terminal domain [54373] (8 families) (S)
    N-terminal domain is beta/beta/alpha common fold
  5. 2542459Family d.16.1.3: D-aminoacid oxidase-like [54384] (3 proteins)
  6. 2542499Protein Glycine oxidase ThiO [89843] (1 species)
  7. 2542500Species Bacillus sp. [TaxId:1409] [89844] (3 PDB entries)
  8. 2542503Domain d1ryic2: 1ryi C:219-306 [118818]
    Other proteins in same PDB: d1ryia1, d1ryib1, d1ryic1, d1ryid1
    automatically matched to d1ng3a2
    complexed with fad, goa

Details for d1ryic2

PDB Entry: 1ryi (more details), 1.8 Å

PDB Description: structure of glycine oxidase with bound inhibitor glycolate
PDB Compounds: (C:) glycine oxidase

SCOPe Domain Sequences for d1ryic2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ryic2 d.16.1.3 (C:219-306) Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]}
flpvkgeclsvwnddipltktlyhdhcyivprksgrlvvgatmkpgdwsetpdlgglesv
mkkaktmlpaiqnmkvdrfwaglrpgtk

SCOPe Domain Coordinates for d1ryic2:

Click to download the PDB-style file with coordinates for d1ryic2.
(The format of our PDB-style files is described here.)

Timeline for d1ryic2: