SCOP 1.75: Domain d1ryib2: 1ryi B:219-306

Lineage for d1ryib2 (1ryi B:219-306)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.16: FAD-linked reductases, C-terminal domain [54372] (1 superfamily)
   alpha+beta sandwich

4. Superfamily d.16.1: FAD-linked reductases, C-terminal domain [54373] (7 families)
   N-terminal domain is beta/beta/alpha common fold

5. Family d.16.1.3: D-aminoacid oxidase-like [54384] (3 proteins)

6. Protein Glycine oxidase ThiO [89843] (1 species)

7. Species Bacillus sp. [TaxId:1409] [89844] (3 PDB entries)

8. Domain d1ryib2: 1ryi B:219-306 [118816]
   Other proteins in same PDB: d1ryia1, d1ryib1, d1ryic1, d1ryid1
   automatically matched to d1ng3a2
   complexed with fad, goa

Details for d1ryib2

PDB Entry: 1ryi, 1.8 Å

PDB Description: structure of glycine oxidase with bound inhibitor glycolate

PDB Compounds: (B:) glycine oxidase

SCOP Domain Sequences for d1ryib2:

Sequence; same for both SEQRES and ATOM records:

>d1ryib2 d.16.1.3 (B:219-306) Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]}
flpvkgeclsvwnddipltktlyhdhcyivprksgrlvvgatmkpgdwsetpdlgglesv
mkkaktmlpaiqnmkvdrfwaglrpgtk

Timeline for d1ryib2:

• d1ryib2 first appeared in SCOP 1.73
  
• d1ryib2 appears in SCOPe 2.01
  
• d1ryib2 appears in the current release, SCOPe 2.08