SCOP 1.73: Domain d1ryia1: 1ryi A:1-218,A:307-364

Lineage for d1ryia1 (1ryi A:1-218,A:307-364)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily)
   core: 3 layers, b/b/a; central parallel beta-sheet of 5 strands, order 32145; top antiparallel beta-sheet of 3 strands, meander

4. Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (7 families)

5. Family c.3.1.2: FAD-linked reductases, N-terminal domain [51913] (15 proteins)
   C-terminal domain is alpha+beta is common for the family

6. Protein Glycine oxidase ThiO [89544] (1 species)

7. Species Bacillus sp. [TaxId:1409] [89545] (3 PDB entries)

8. Domain d1ryia1: 1ryi A:1-218,A:307-364 [118813]
   Other proteins in same PDB: d1ryia2, d1ryib2, d1ryic2, d1ryid2
   automatically matched to d1ng3a1
   complexed with fad, goa

Details for d1ryia1

PDB Entry: 1ryi, 1.8 Å

PDB Description: structure of glycine oxidase with bound inhibitor glycolate

PDB Compounds: (A:) glycine oxidase

SCOP Domain Sequences for d1ryia1:

Sequence; same for both SEQRES and ATOM records:

>d1ryia1 c.3.1.2 (A:1-218,A:307-364) Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]}
mkrhyeavvigggiigsaiayylakenkntalfesgtmggrttsaaagmlgahaeceerd
affdfamhsqrlykglgeelyalsgvdirqhnggmfklafseedvlqlrqmddldsvswy
skeevlekepyasgdifgasfiqddvhvepyfvckayvkaakmlgaeifehtpvlhverd
gealfiktpsgdvwanhvvvasgvwsgmffkqlglnnaXdgkpyigrhpedsrilfaagh
frngillapatgalisdlimnkevnqdwlhafridrk

Timeline for d1ryia1:

• d1ryia1 is new in SCOP 1.73
  
• d1ryia1 appears in SCOP 1.75
  
• d1ryia1 appears in the current release, SCOPe 2.08