Lineage for d1ryed2 (1rye D:161-322)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1033075Fold d.81: FwdE/GAPDH domain-like [55346] (4 superfamilies)
    core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1
  4. 1033076Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families) (S)
    N-terminal domain is the classic Rossmann-fold
  5. 1033543Family d.81.1.5: Glucose 6-phosphate dehydrogenase-like [55376] (7 proteins)
    has many additional secondary structures
  6. 1033576Protein Glucose-fructose oxidoreductase [55377] (1 species)
    very similar to the glucose 6-phosphate dehydrogenase domain
  7. 1033577Species Zymomonas mobilis [TaxId:542] [55378] (8 PDB entries)
  8. 1033597Domain d1ryed2: 1rye D:161-322 [118812]
    Other proteins in same PDB: d1ryea1, d1ryeb1, d1ryec1, d1ryed1
    automatically matched to d1evja2
    complexed with bme, gol, ndp

Details for d1ryed2

PDB Entry: 1rye (more details), 2.3 Å

PDB Description: Crystal Structure of the Shifted Form of the Glucose-Fructose Oxidoreductase from Zymomonas mobilis
PDB Compounds: (D:) glucose-fructose oxidoreductase

SCOPe Domain Sequences for d1ryed2:

Sequence, based on SEQRES records: (download)

>d1ryed2 d.81.1.5 (D:161-322) Glucose-fructose oxidoreductase {Zymomonas mobilis [TaxId: 542]}
dpmnraavklirenqlgklgmvttdnsdvmdqndpaqqwrlrrelagggslmdigiygln
gtryllgeepievraytysdpnderfvevedriiwqmrfrsgalshgassysttttsrfs
vqgdkavllmdpatgyyqnlisvqtpghanqsmmpqfimpan

Sequence, based on observed residues (ATOM records): (download)

>d1ryed2 d.81.1.5 (D:161-322) Glucose-fructose oxidoreductase {Zymomonas mobilis [TaxId: 542]}
dpmnraavklirenqlgklgmvttdnsdvmdqndpaqqwrlrrelagggslmdigiygln
gtryllgeepievraytysdpnderfvevedriiwqmrfrsgalshgassysttttsrfs
vqgdkavllmdpatgyyqnlisvqtpghanqsmmpan

SCOPe Domain Coordinates for d1ryed2:

Click to download the PDB-style file with coordinates for d1ryed2.
(The format of our PDB-style files is described here.)

Timeline for d1ryed2: