Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) |
Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (22 proteins) family members also share a common alpha+beta fold in C-terminal domain |
Protein Glucose-fructose oxidoreductase, N-terminal domain [51825] (1 species) |
Species Zymomonas mobilis [TaxId:542] [51826] (8 PDB entries) |
Domain d1ryed1: 1rye D:30-160,D:323-381 [118811] Other proteins in same PDB: d1ryea2, d1ryeb2, d1ryec2, d1ryed2 automatically matched to d1evja1 complexed with bme, gol, ndp |
PDB Entry: 1rye (more details), 2.3 Å
SCOPe Domain Sequences for d1ryed1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ryed1 c.2.1.3 (D:30-160,D:323-381) Glucose-fructose oxidoreductase, N-terminal domain {Zymomonas mobilis [TaxId: 542]} rrfgyaivglgkyalnqilpgfagcqhsriealvsgnaekakivaaeygvdprkiydysn fdkiakdpkidavyiilpnslhaefairafkagkhvmcekpmatsvadcqrmidaakaan kklmigyrchyXnqfsaqldhlaeavinnkpvrspgeegmqdvrliqaiyeaartgrpvn tdwgyvrqggy
Timeline for d1ryed1: