Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.81: FwdE/GAPDH domain-like [55346] (4 superfamilies) core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1 |
Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families) N-terminal domain is the classic Rossmann-fold |
Family d.81.1.5: Glucose 6-phosphate dehydrogenase-like [55376] (7 proteins) has many additional secondary structures |
Protein Glucose-fructose oxidoreductase [55377] (1 species) very similar to the glucose 6-phosphate dehydrogenase domain |
Species Zymomonas mobilis [TaxId:542] [55378] (8 PDB entries) |
Domain d1ryec2: 1rye C:161-322 [118810] Other proteins in same PDB: d1ryea1, d1ryeb1, d1ryec1, d1ryed1 automatically matched to d1evja2 complexed with bme, gol, ndp |
PDB Entry: 1rye (more details), 2.3 Å
SCOPe Domain Sequences for d1ryec2:
Sequence, based on SEQRES records: (download)
>d1ryec2 d.81.1.5 (C:161-322) Glucose-fructose oxidoreductase {Zymomonas mobilis [TaxId: 542]} dpmnraavklirenqlgklgmvttdnsdvmdqndpaqqwrlrrelagggslmdigiygln gtryllgeepievraytysdpnderfvevedriiwqmrfrsgalshgassysttttsrfs vqgdkavllmdpatgyyqnlisvqtpghanqsmmpqfimpan
>d1ryec2 d.81.1.5 (C:161-322) Glucose-fructose oxidoreductase {Zymomonas mobilis [TaxId: 542]} dpmnraavklirenqlgklgmvttdnsdvmdqndpaqqwrlrrelagggslmdigiygln gtryllgeepievraytysdpnderfvevedriiwqmrfrsgalshgassysttttsrfs vqgdkavllmdpatgyyqnlisvqtppan
Timeline for d1ryec2: