SCOP 1.75: Domain d1ryea2: 1rye A:161-322

Lineage for d1ryea2 (1rye A:161-322)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.81: FwdE/GAPDH domain-like [55346] (4 superfamilies)
   core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1

4. Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families)
   N-terminal domain is the classic Rossmann-fold

5. Family d.81.1.5: Glucose 6-phosphate dehydrogenase-like [55376] (7 proteins)
   has many additional secondary structures

6. Protein Glucose-fructose oxidoreductase [55377] (1 species)
   very similar to the glucose 6-phosphate dehydrogenase domain

7. Species Zymomonas mobilis [TaxId:542] [55378] (8 PDB entries)

8. Domain d1ryea2: 1rye A:161-322 [118806]
   Other proteins in same PDB: d1ryea1, d1ryeb1, d1ryec1, d1ryed1
   automatically matched to d1evja2
   complexed with bme, gol, ndp

Details for d1ryea2

PDB Entry: 1rye, 2.3 Å

PDB Description: Crystal Structure of the Shifted Form of the Glucose-Fructose Oxidoreductase from Zymomonas mobilis

PDB Compounds: (A:) glucose-fructose oxidoreductase

SCOP Domain Sequences for d1ryea2:

Sequence, based on SEQRES records:

>d1ryea2 d.81.1.5 (A:161-322) Glucose-fructose oxidoreductase {Zymomonas mobilis [TaxId: 542]}
dpmnraavklirenqlgklgmvttdnsdvmdqndpaqqwrlrrelagggslmdigiygln
gtryllgeepievraytysdpnderfvevedriiwqmrfrsgalshgassysttttsrfs
vqgdkavllmdpatgyyqnlisvqtpghanqsmmpqfimpan

Sequence, based on observed residues (ATOM records):

>d1ryea2 d.81.1.5 (A:161-322) Glucose-fructose oxidoreductase {Zymomonas mobilis [TaxId: 542]}
dpmnraavklirenqlgklgmvttdnsdvmdqndpaqqwrlrrelagggslmdigiygln
gtryllgeepievraytysdpnderfvevedriiwqmrfrsgalshgassysttttsrfs
vqgdkavllmdpatgyyqnlisvqtppan

Timeline for d1ryea2:

• d1ryea2 first appeared in SCOP 1.73
  
• d1ryea2 appears in SCOPe 2.01
  
• d1ryea2 appears in the current release, SCOPe 2.08