SCOPe 2.05: Domain d1rydb2: 1ryd B:161-322

Lineage for d1rydb2 (1ryd B:161-322)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.81: FwdE/GAPDH domain-like [55346] (4 superfamilies)
   core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1

4. Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families)
   N-terminal domain is the classic Rossmann-fold

5. Family d.81.1.5: Glucose 6-phosphate dehydrogenase-like [55376] (7 proteins)
   has many additional secondary structures

6. Protein Glucose-fructose oxidoreductase [55377] (1 species)
   very similar to the glucose 6-phosphate dehydrogenase domain

7. Species Zymomonas mobilis [TaxId:542] [55378] (8 PDB entries)

8. Domain d1rydb2: 1ryd B:161-322 [118804]
   Other proteins in same PDB: d1ryda1, d1rydb1
   automatically matched to d1evja2
   complexed with act, bme, glc, ndp

Details for d1rydb2

PDB Entry: 1ryd, 2.2 Å

PDB Description: crystal structure of glucose-fructose oxidoreductase from zymomonas mobilis

PDB Compounds: (B:) glucose-fructose oxidoreductase

SCOPe Domain Sequences for d1rydb2:

Sequence; same for both SEQRES and ATOM records:

>d1rydb2 d.81.1.5 (B:161-322) Glucose-fructose oxidoreductase {Zymomonas mobilis [TaxId: 542]}
dpmnraavklirenqlgklgmvttdnsdvmdqndpaqqwrlrrelagggslmdigiygln
gtryllgeepievraytysdpnderfvevedriiwqmrfrsgalshgassysttttsrfs
vqgdkavllmdpatgyyqnlisvqtpghanqsmmpqfimpan

Timeline for d1rydb2:

• d1rydb2 first appeared in SCOP 1.73
  
• d1rydb2 appears in SCOPe 2.04
  
• d1rydb2 appears in SCOPe 2.06
  
• d1rydb2 appears in the current release, SCOPe 2.08