Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily) 3 layers: a/b/a; contains mixed beta-sheet |
Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (12 families) |
Family d.108.1.2: N-myristoyl transferase, NMT [55748] (1 protein) duplication: consists of two NAT-like domains swapped with the C-terminal strands |
Protein N-myristoyl transferase, NMT [55749] (4 species) |
Species Human (Homo sapiens) [TaxId:9606] [143710] (1 PDB entry) Uniprot P30419 155-294! Uniprot P30419 295-496 |
Domain d1rxtd2: 1rxt D:219-455 [118800] automated match to d3iu1a2 complexed with co, so4 |
PDB Entry: 1rxt (more details), 3 Å
SCOPe Domain Sequences for d1rxtd2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1rxtd2 d.108.1.2 (D:219-455) N-myristoyl transferase, NMT {Human (Homo sapiens) [TaxId: 9606]} ywhrslnprklievkfshlsrnmtmqrtmklyrlpetpktaglrpmetkdipvvhqlltr ylkqfhltpvmsqeevehwfypqeniidtfvvenangevtdflsfytlpstimnhpthks lkaaysfynvhtqtplldlmsdalvlakmkgfdvfnaldlmenktfleklkfgigdgnlq yylynwkcpsmgaekvgivlq
Timeline for d1rxtd2: