Lineage for d1rxtb2 (1rxt B:219-455)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
    3 layers: a/b/a; contains mixed beta-sheet
  4. Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (12 families) (S)
  5. Family d.108.1.2: N-myristoyl transferase, NMT [55748] (1 protein)
    duplication: consists of two NAT-like domains swapped with the C-terminal strands
  6. Protein N-myristoyl transferase, NMT [55749] (4 species)
  7. Species Human (Homo sapiens) [TaxId:9606] [143710] (1 PDB entry)
    Uniprot P30419 155-294! Uniprot P30419 295-496
  8. Domain d1rxtb2: 1rxt B:219-455 [118796]
    automated match to d3iu1a2
    complexed with co, so4

Details for d1rxtb2

PDB Entry: 1rxt (more details), 3 Å

PDB Description: Crystal structure of human myristoyl-CoA:protein N-myristoyltransferase.
PDB Compounds: (B:) Glycylpeptide N-tetradecanoyltransferase 1

SCOPe Domain Sequences for d1rxtb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rxtb2 d.108.1.2 (B:219-455) N-myristoyl transferase, NMT {Human (Homo sapiens) [TaxId: 9606]}
ywhrslnprklievkfshlsrnmtmqrtmklyrlpetpktaglrpmetkdipvvhqlltr
ylkqfhltpvmsqeevehwfypqeniidtfvvenangevtdflsfytlpstimnhpthks
lkaaysfynvhtqtplldlmsdalvlakmkgfdvfnaldlmenktfleklkfgigdgnlq
yylynwkcpsmgaekvgivlq

SCOPe Domain Coordinates for d1rxtb2 are not available.

Timeline for d1rxtb2:

Domains from same chain:
(mouse over for more information)
d1rxtb1
Domains from other chains:
(mouse over for more information)
d1rxta1, d1rxta2, d1rxtc1, d1rxtc2, d1rxtd1, d1rxtd2