![]() | Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
![]() | Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily) 3 layers: a/b/a; contains mixed beta-sheet |
![]() | Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families) ![]() |
![]() | Family d.108.1.2: N-myristoyl transferase, NMT [55748] (1 protein) duplication: consists of two NAT-like domains swapped with the C-terminal strands |
![]() | Protein N-myristoyl transferase, NMT [55749] (3 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [143710] (1 PDB entry) Uniprot P30419 155-294! Uniprot P30419 295-496 |
![]() | Domain d1rxta1: 1rxt A:78-218 [118793] complexed with co, so4 |
PDB Entry: 1rxt (more details), 3 Å
SCOPe Domain Sequences for d1rxta1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1rxta1 d.108.1.2 (A:78-218) N-myristoyl transferase, NMT {Human (Homo sapiens) [TaxId: 9606]} gftwdaldlgdrgvlkelytllnenyvedddnmfrfdyspefllwalrppgwlpqwhcgv rvvssrklvgfisaipanihiydtekkmveinflcvhkklrskrvapvlireitrrvhle gifqavytagvvlpkpvgtcr
Timeline for d1rxta1: