SCOPe 2.06: Domain d1rw5a_: 1rw5 A:

Lineage for d1rw5a_ (1rw5 A:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.26: 4-helical cytokines [47265] (1 superfamily)
   core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections

4. Superfamily a.26.1: 4-helical cytokines [47266] (4 families)
   there are two different topoisomers of this fold with different entanglements of the two crossover connections

5. Family a.26.1.1: Long-chain cytokines [47267] (10 proteins)

6. Protein Prolactin (placental lactogen) [47278] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [89035] (4 PDB entries)

8. Domain d1rw5a_: 1rw5 A: [118792]
   automated match to d1rw5a1

Details for d1rw5a_

PDB Entry: 1rw5

PDB Description: solution structure of human prolactin

PDB Compounds: (A:) Prolactin

SCOPe Domain Sequences for d1rw5a_:

Sequence; same for both SEQRES and ATOM records:

>d1rw5a_ a.26.1.1 (A:) Prolactin (placental lactogen) {Human (Homo sapiens) [TaxId: 9606]}
lpicpggaarcqvtlrdlfdravvlshyihnlssemfsefdkrythgrgfitkainscht
sslatpedkeqaqqmnqkdflslivsilrswneplyhlvtevrgmqeapeailskaveie
eqtkrllegmelivsqvhpetkeneiypvwsglpslqmadeesrlsayynllhclrrdsh
kidnylkllkcriihnnnc

Timeline for d1rw5a_:

• d1rw5a_ first appeared in SCOP 1.73, called d1rw5a1
  
• d1rw5a_ appears in SCOPe 2.05
  
• d1rw5a_ appears in SCOPe 2.07
  
• d1rw5a_ appears in the current release, SCOPe 2.08