Class a: All alpha proteins [46456] (289 folds) |
Fold a.26: 4-helical cytokines [47265] (1 superfamily) core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections |
Superfamily a.26.1: 4-helical cytokines [47266] (4 families) there are two different topoisomers of this fold with different entanglements of the two crossover connections |
Family a.26.1.1: Long-chain cytokines [47267] (10 proteins) |
Protein Prolactin (placental lactogen) [47278] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [89035] (4 PDB entries) |
Domain d1rw5a_: 1rw5 A: [118792] automated match to d1rw5a1 |
PDB Entry: 1rw5 (more details)
SCOPe Domain Sequences for d1rw5a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1rw5a_ a.26.1.1 (A:) Prolactin (placental lactogen) {Human (Homo sapiens) [TaxId: 9606]} lpicpggaarcqvtlrdlfdravvlshyihnlssemfsefdkrythgrgfitkainscht sslatpedkeqaqqmnqkdflslivsilrswneplyhlvtevrgmqeapeailskaveie eqtkrllegmelivsqvhpetkeneiypvwsglpslqmadeesrlsayynllhclrrdsh kidnylkllkcriihnnnc
Timeline for d1rw5a_: