Lineage for d1rw5a1 (1rw5 A:1-199)

  1. Root: SCOPe 2.02
  2. 1074916Class a: All alpha proteins [46456] (284 folds)
  3. 1085916Fold a.26: 4-helical cytokines [47265] (1 superfamily)
    core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections
  4. 1085917Superfamily a.26.1: 4-helical cytokines [47266] (4 families) (S)
    there are two different topoisomers of this fold with different entanglements of the two crossover connections
  5. 1085918Family a.26.1.1: Long-chain cytokines [47267] (10 proteins)
  6. 1085982Protein Prolactin (placental lactogen) [47278] (2 species)
  7. 1085983Species Human (Homo sapiens) [TaxId:9606] [89035] (3 PDB entries)
  8. 1085986Domain d1rw5a1: 1rw5 A:1-199 [118792]
    automatically matched to d1n9da_

Details for d1rw5a1

PDB Entry: 1rw5 (more details)

PDB Description: solution structure of human prolactin
PDB Compounds: (A:) Prolactin

SCOPe Domain Sequences for d1rw5a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rw5a1 a.26.1.1 (A:1-199) Prolactin (placental lactogen) {Human (Homo sapiens) [TaxId: 9606]}
lpicpggaarcqvtlrdlfdravvlshyihnlssemfsefdkrythgrgfitkainscht
sslatpedkeqaqqmnqkdflslivsilrswneplyhlvtevrgmqeapeailskaveie
eqtkrllegmelivsqvhpetkeneiypvwsglpslqmadeesrlsayynllhclrrdsh
kidnylkllkcriihnnnc

SCOPe Domain Coordinates for d1rw5a1:

Click to download the PDB-style file with coordinates for d1rw5a1.
(The format of our PDB-style files is described here.)

Timeline for d1rw5a1: