SCOP 1.73: Domain d1rw5a1: 1rw5 A:1-199

Lineage for d1rw5a1 (1rw5 A:1-199)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.26: 4-helical cytokines [47265] (1 superfamily)
   core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections

4. Superfamily a.26.1: 4-helical cytokines [47266] (3 families)
   there are two different topoisomers of this fold with different entanglements of the two crossover connections

5. Family a.26.1.1: Long-chain cytokines [47267] (9 proteins)

6. Protein Prolactin (placental lactogen) [47278] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [89035] (2 PDB entries)

8. Domain d1rw5a1: 1rw5 A:1-199 [118792]
   automatically matched to d1n9da_

Details for d1rw5a1

PDB Entry: 1rw5

PDB Description: solution structure of human prolactin

PDB Compounds: (A:) Prolactin

SCOP Domain Sequences for d1rw5a1:

Sequence; same for both SEQRES and ATOM records:

>d1rw5a1 a.26.1.1 (A:1-199) Prolactin (placental lactogen) {Human (Homo sapiens) [TaxId: 9606]}
lpicpggaarcqvtlrdlfdravvlshyihnlssemfsefdkrythgrgfitkainscht
sslatpedkeqaqqmnqkdflslivsilrswneplyhlvtevrgmqeapeailskaveie
eqtkrllegmelivsqvhpetkeneiypvwsglpslqmadeesrlsayynllhclrrdsh
kidnylkllkcriihnnnc

Timeline for d1rw5a1:

• d1rw5a1 is new in SCOP 1.73
  
• d1rw5a1 appears in SCOP 1.75
  
• d1rw5a1 appears in the current release, SCOPe 2.08, called d1rw5a_