Lineage for d1rw5a_ (1rw5 A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2705447Fold a.26: 4-helical cytokines [47265] (1 superfamily)
    core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections
  4. 2705448Superfamily a.26.1: 4-helical cytokines [47266] (4 families) (S)
    there are two different topoisomers of this fold with different entanglements of the two crossover connections
  5. 2705449Family a.26.1.1: Long-chain cytokines [47267] (10 proteins)
  6. 2705520Protein Prolactin (placental lactogen) [47278] (2 species)
  7. 2705521Species Human (Homo sapiens) [TaxId:9606] [89035] (4 PDB entries)
  8. 2705524Domain d1rw5a_: 1rw5 A: [118792]
    automated match to d1rw5a1

Details for d1rw5a_

PDB Entry: 1rw5 (more details)

PDB Description: solution structure of human prolactin
PDB Compounds: (A:) Prolactin

SCOPe Domain Sequences for d1rw5a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rw5a_ a.26.1.1 (A:) Prolactin (placental lactogen) {Human (Homo sapiens) [TaxId: 9606]}
lpicpggaarcqvtlrdlfdravvlshyihnlssemfsefdkrythgrgfitkainscht
sslatpedkeqaqqmnqkdflslivsilrswneplyhlvtevrgmqeapeailskaveie
eqtkrllegmelivsqvhpetkeneiypvwsglpslqmadeesrlsayynllhclrrdsh
kidnylkllkcriihnnnc

SCOPe Domain Coordinates for d1rw5a_:

Click to download the PDB-style file with coordinates for d1rw5a_.
(The format of our PDB-style files is described here.)

Timeline for d1rw5a_: