SCOPe 2.08: Domain d1rt9a_: 1rt9 A:

Lineage for d1rt9a_ (1rt9 A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
   core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops

4. Superfamily c.56.2: Purine and uridine phosphorylases [53167] (2 families)
   complex architecture; contains mixed beta-sheet of 8 strands, order 23415867, strands 3, 6 & 7 are antiparallel to the rest; and barrel, closed; n=5, S=8

5. Family c.56.2.1: Purine and uridine phosphorylases [53168] (7 proteins)

6. Protein Purine nucleoside phosphorylase, PNP [53169] (14 species)

7. Species Human (Homo sapiens) [TaxId:9606] [53170] (29 PDB entries)
   Uniprot P00491

8. Domain d1rt9a_: 1rt9 A: [118791]
   automated match to d1ula__
   complexed with imh, so4

Details for d1rt9a_

PDB Entry: 1rt9, 2.3 Å

PDB Description: structure of human purine nucleoside phosphorylase in complex with immucillin-h and sulfate

PDB Compounds: (A:) purine nucleoside phosphorylase

SCOPe Domain Sequences for d1rt9a_:

Sequence; same for both SEQRES and ATOM records:

>d1rt9a_ c.56.2.1 (A:) Purine nucleoside phosphorylase, PNP {Human (Homo sapiens) [TaxId: 9606]}
ngytyedykntaewllshtkhrpqvaiicgsglggltdkltqaqifdyseipnfprstvp
ghagrlvfgflngracvmmqgrfhmyegyplwkvtfpvrvfhllgvdtlvvtnaagglnp
kfevgdimlirdhinlpgfsgqnplrgpnderfgdrfpamsdaydrtmrqralstwkqmg
eqrelqegtyvmvagpsfetvaecrvlqklgadavgmstvpevivarhcglrvfgfslit
nkvimdyeslekanheevlaagkqaaqkleqfvsilmasipl

Timeline for d1rt9a_:

• d1rt9a_ first appeared in SCOP 1.73, called d1rt9a1
  
• d1rt9a_ appears in SCOPe 2.07