Lineage for d1rsza1 (1rsz A:3-284)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 837609Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
    core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops
  4. 837625Superfamily c.56.2: Purine and uridine phosphorylases [53167] (1 family) (S)
    complex architecture; contains mixed beta-sheet of 8 strands, order 23415867, strands 3, 6 & 7 are antiparallel to the rest; and barrel, closed; n=5, S=8
  5. 837626Family c.56.2.1: Purine and uridine phosphorylases [53168] (6 proteins)
  6. 837718Protein Purine nucleoside phosphorylase, PNP [53169] (9 species)
  7. 837830Species Human (Homo sapiens) [TaxId:9606] [53170] (17 PDB entries)
    Uniprot P00491
  8. 837832Domain d1rsza1: 1rsz A:3-284 [118790]
    automatically matched to d1ula__
    complexed with dih, so4

Details for d1rsza1

PDB Entry: 1rsz (more details), 2.2 Å

PDB Description: structure of human purine nucleoside phosphorylase in complex with dadme-immucillin-h and sulfate
PDB Compounds: (A:) purine nucleoside phosphorylase

SCOP Domain Sequences for d1rsza1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rsza1 c.56.2.1 (A:3-284) Purine nucleoside phosphorylase, PNP {Human (Homo sapiens) [TaxId: 9606]}
ngytyedykntaewllshtkhrpqvaiicgsglggltdkltqaqifdyseipnfprstvp
ghagrlvfgflngracvmmqgrfhmyegyplwkvtfpvrvfhllgvdtlvvtnaagglnp
kfevgdimlirdhinlpgfsgqnplrgpnderfgdrfpamsdaydrtmrqralstwkqmg
eqrelqegtyvmvagpsfetvaecrvlqklgadavgmstvpevivarhcglrvfgfslit
nkvimdyeslekanheevlaagkqaaqkleqfvsilmasipl

SCOP Domain Coordinates for d1rsza1:

Click to download the PDB-style file with coordinates for d1rsza1.
(The format of our PDB-style files is described here.)

Timeline for d1rsza1: