Lineage for d1rpka2 (1rpk A:1-347)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2829818Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2829819Family c.1.8.1: Amylase, catalytic domain [51446] (26 proteins)
    members of the family may contain various insert subdomains
    in alpha-amylases and closer relatives this domain is usually followed by a common all-beta domain
  6. 2830315Protein Plant alpha-amylase [51474] (2 species)
  7. 2830316Species Barley (Hordeum vulgare), AMY1 isozyme [TaxId:4513] [89465] (7 PDB entries)
  8. 2830321Domain d1rpka2: 1rpk A:1-347 [118788]
    Other proteins in same PDB: d1rpka1
    automated match to d1ht6a2
    complexed with ca

Details for d1rpka2

PDB Entry: 1rpk (more details), 2 Å

PDB Description: crystal structure of barley alpha-amylase isozyme 1 (amy1) in complex with acarbose
PDB Compounds: (A:) Alpha-amylase type 1 isozyme

SCOPe Domain Sequences for d1rpka2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rpka2 c.1.8.1 (A:1-347) Plant alpha-amylase {Barley (Hordeum vulgare), AMY1 isozyme [TaxId: 4513]}
hqvlfqgfnweswkqsggwynmmmgkvddiaaagvthvwlpppshsvsnegympgrlydi
daskygnaaelksligalhgkgvqaiadivinhrcadykdsrgiycifeggtsdgrldwg
phmicrddtkysdgtanldtgadfaaapdidhlndrvqrelkewllwlksdlgfdawrld
fargyspemakvyidgtspslavaevwdnmatggdgkpnydqdahrqnlvnwvdkvggaa
sagmvfdfttkgilnaavegelwrlidpqgkapgvmgwwpakavtfvdnhdtgstqamwp
fpsdkvmqgyayilthpgipcifydhffnwgfkdqiaalvairkrng

SCOPe Domain Coordinates for d1rpka2:

Click to download the PDB-style file with coordinates for d1rpka2.
(The format of our PDB-style files is described here.)

Timeline for d1rpka2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1rpka1